GCOM1 Rabbit Polyclonal Antibody TA339965 from OriGene Technologies | Biocompare.com

Supplier Images

GCOM1 Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
GCOM1 Rabbit Polyclonal Antibody

OriGene Technologies' GCOM1 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The GCOM1 Rabbit Polyclonal Antibody was generated using GCOM1, and Myzap as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-Gcom1 Antibody

Product Specs
ItemGCOM1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA339965
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetGcom1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Gcom1 antibody: synthetic peptide directed towards the middle region of human Gcom1. Synthetic peptide located within the following region: VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK
NCBI Full Gene NameGCOM1, MYZAP-POLR2M combined locus, myocardial zonula adherens protein
NCBI Gene AliasesGRINL1A, MYZAP-POLR2M, Gcom2, GCOM1, gcom, Gup, MYZAP, MYOZAP
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!